PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN25315.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Nin-like
Protein Properties Length: 1000aa    MW: 111119 Da    PI: 6.4485
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN25315.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.14.1e-29629679252
      RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                 ek++sl++l++yFs+++kdAAk++gvc+T+LKriCRq+GI+RWP+Rki+++
  KHN25315.1 629 EKNVSLSVLQQYFSGSLKDAAKSIGVCPTTLKRICRQHGISRWPSRKINKV 679
                 79***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.234611699IPR003035RWP-RK domain
PfamPF020422.6E-26631679IPR003035RWP-RK domain
SuperFamilySSF542771.9E-21897984No hitNo description
Gene3DG3DSA:3.10.20.2402.4E-22897979No hitNo description
PROSITE profilePS5174521.363900982IPR000270PB1 domain
SMARTSM006662.1E-21900982IPR000270PB1 domain
CDDcd064071.62E-29901981No hitNo description
PfamPF005644.2E-16903981IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1000 aa     Download sequence    Send to blast
MEDHVSPEGK EVSCCAPPGA QLEESTSVDG GKKNSSSEDM FSNFSELMNF DTYAGWSNSP  60
SMTDLSVANV FSLFSSAPYP PPDGLNLVEQ SNGSFFMTED SEFHNGMESS PSCVERVIFQ  120
QMDIHLGFLD EANDSNNLDS KEKLNGKSQQ VNTSDMCNYI ISRSPGRSLD DRMLRALSFF  180
MESADEGMLA QVWVPTKHGD EFILSTSQQP YLLDPKLAGY REVSRAFTFS AEGKTRTCPG  240
LPARVFISHV PEWTSNVGYY NKTEYLRLEH AKNHEIRGSI ALPISDVHSQ VPCAVLELVT  300
TKEKANFDRE LEIFSHALQR LGYLSTKVIM EKFLPCTNDK CLYDDFKQLV NLRTSMPPRL  360
LPQCLSSNKR VALTEIIDVL RAMCHAHRLP LALTWIPCCY SEGIRDETER IRIKEGHTSS  420
NEKCVLCIEE SACYVNDGGV GGFVHACIEH HLEEGQGIAG KALQSNHPFF YTDVKTYDIG  480
EYPLVHHARK YNLNAAVAIR LRSTYTNGDD YILEFFLPVN MTGSSEQQLL LDNLSGTMRR  540
ICKSLRTVSD AELTGIDGSQ GGFPKEKVSG FFPMSRRNSE IAFINGDHDS VQKMSMKTSN  600
MRNNGTEAVH SQAMNGSRKQ VEKKRSTVEK NVSLSVLQQY FSGSLKDAAK SIGVCPTTLK  660
RICRQHGISR WPSRKINKVN RSLKKIQTVL DSVQGVEGGL KFDPYTGGFI AGGSIMQEID  720
AHKYLVFPKK SSVKDPKPAT QKTVSVAPAP GSTRENSTIK LNDDESVCLV RNKFVHSRNV  780
LNSNSSKGEL KKDNVSSDDC CDDSKSMAMN DGSCQKSCLW TKTQDCPEQT CSISLVTDEV  840
EVGVDRVEGA DEHNHPTSSS TTHSSNGSGS MMHGSSSCSQ SFEKQKHSKV KSNCVDSGSK  900
MIVKASYRGD TIRFKFDPSS GCFQLYEEVA TRFKLQNGSF QLKYLDDEEE WVMLVNDSDL  960
QECTEILGDI GTRFVKFLVR DVPCVFRSRG SNSCFLSDSS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2351720.0AC235172.1 Glycine max strain Williams 82 clone GM_WBb0002N17, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006592131.10.0PREDICTED: protein NLP9-like
RefseqXP_014619984.10.0PREDICTED: protein NLP9-like
RefseqXP_014619985.10.0PREDICTED: protein NLP9-like
RefseqXP_014619986.10.0PREDICTED: protein NLP9-like
SwissprotO228640.0NLP8_ARATH; Protein NLP8
TrEMBLA0A0B2QUV20.0A0A0B2QUV2_GLYSO; Protein NLP8
STRINGGLYMA12G05390.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34643465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43500.20.0Nin-like family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]